PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016436950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 999aa    MW: 110973 Da    PI: 6.0343
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016436950.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.99.2e-41143220178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C +dls+ak+yhrrhkvCe+hska+ +lv +++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+q+
  XP_016436950.1 143 VCQVDDCGTDLSKAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTQS 220
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-33138205IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.086141218IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.98E-38142223IPR004333Transcription factor, SBP-box
PfamPF031107.8E-30144217IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.19E-7771884IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.204.2E-5773885IPR020683Ankyrin repeat-containing domain
CDDcd002043.05E-6774884No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 999 aa     Download sequence    Send to blast
MEASVGERYY HMGGPDLRGL GKRSLEWDVT DWKWDGDLFI ATPLRQNPSN NYQSRQFFPV  60
ETGNLVASSN SSSSCSDETN HGIEQQRREL EKRRRVIIVD ENDSGGTLSL KLGGQAEPVA  120
EKRTKLAAAA PAPAPVTGTT RAVCQVDDCG TDLSKAKDYH RRHKVCEMHS KASRALVGNV  180
MQRFCQQCSR FHALQEFDEG KRSCRRRLAG HNKRRRKTQS ESVANNNSSN DGQASGYSLM  240
SLLKMLSNMH SNGTNHSEDQ DLLAHLLRSI AGQGSLNGDK SLSGLLQESS DLLNNRSILR  300
NPELASLISN GSQAPPRAKE HQFTNSAAEV PQKRLDAHDV RLEDARTASS QSPGILFPPI  360
QSNSQAYAQG RGSTTGRSKL IDFDLNDVYV DSDDNIEDID RSPVQCPSWL QQDSHQSSPP  420
QTSGNSDSAS AQSPSSSSGD TQTRTDRIVF KLFGKDPSDF PFVVRAQILD WLSHSPTEIE  480
SYIRPGCVVL TVYLRLPESA WEELCYDLNS SLSRLLDVHG DDSFWTKGWI YISVQNQIAF  540
VCDGQVLLDM SLPSGSDEHS TILSVRPIAV PVSGRAQFLV KGYNLSKPST RLLCALESNY  600
LVPEANNEVE EHVDGIDKDD KLQSLDFTCS VPAVTGRGFI EVEDHGLSNS FFPFIVAEED  660
VCSEIRMLES ELDLTSANYV KGQINNMEAR NQAMDFIHEL GWLLHRNNLK ARLEHFGPDA  720
VLYPLKRFKW LIDFCVDHEW CAVVKKLLNV LLGGTVGAGE SSFLKFALTE MGLLHRAVRR  780
NSRPLVELLL TYTPEKVADE LSSEYQSLVE ADGEFLFRPD CVGPAGLTPL HVAAGIDGSE  840
DVLDALTDDP GKVAIEAWKN TRDSTGFTPE DYARLRGHYS YIHLVQRKIS KKAISGHIVV  900
DIPIVPSIEN SNQKEEEFAT NSLEISMTER RPISRPCGLC HKKLAYGSRS RSLLYRPAMF  960
SMVAMAAVCV CVALLFRGSP EVLYIFRPFR WEMVDFGTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-311432171084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19195KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016436950.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A1S3XAJ50.0A0A1S3XAJ5_TOBAC; squamosa promoter-binding-like protein 1
STRINGXP_009796558.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jung S, et al.
    Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes.
    BMC Genomics, 2006. 7: p. 81
    [PMID:16615871]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]