PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016436404.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 231aa    MW: 25036.5 Da    PI: 8.7169
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016436404.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.63.3e-41501491100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++p  +r da++slvyeA++r+rdPvyG++g i++lqqql++l+ael+
  XP_016436404.1  50 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLLEVPVGQRADAANSLVYEANVRLRDPVYGCMGAISTLQQQLQTLQAELN 144
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_016436404.1 145 AIRSE 149
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.99149150IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4150147IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSRERERLDE IGKKLKTEID ASSQLHMQQQ MGRRQILGPA AGTTLNTITP CAACKLLRRR  60
CAEECPFSPY FSPHEPQKFA AVHKVFGASN VSKLLLEVPV GQRADAANSL VYEANVRLRD  120
PVYGCMGAIS TLQQQLQTLQ AELNAIRSEI LRYKYREAAN NLIASISTSV ADQLPQAPPT  180
PPPPPPPLPS VVVVSSSSST SSVSSLYTPP SSAGANFSAA IHNNSISYFD Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-46401571118LOB family transfactor Ramosa2.1
5ly0_B3e-46401571118LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589291.11e-169PREDICTED: LOB domain-containing protein 15-like isoform X2
RefseqXP_016436404.11e-169PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T53e-76LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A1S3X9B51e-168A0A1S3X9B5_TOBAC; LOB domain-containing protein 15-like
STRINGXP_009589291.11e-169(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-78LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]