PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016436043.1
Common NameNtMADS4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 27959.7 Da    PI: 9.6159
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016436043.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF977.9e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+gkl e++s
  XP_016436043.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLSEFCS 59
                    79***********************************************96 PP

2K-box100.62.1e-33811747100
           K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      + ++ ++++ ++e+ +Lk+++e Lqr+qR+llGedL++L+ +eL++Le+qL++slk+iRs+K++ +l+q+ +lq+ke++l e+nk+Lr+klee
  XP_016436043.1  81 MQSASDHTQNNYHEYLRLKARVELLQRSQRNLLGEDLGTLNSRELEHLEHQLDSSLKQIRSRKTQNMLDQLADLQQKEQMLAEANKQLRRKLEE 174
                     4567889************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.646161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-40160IPR002100Transcription factor, MADS-box
CDDcd002659.08E-45279No hitNo description
SuperFamilySSF554551.2E-33280IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.4E-2783172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.9188178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0048440Biological Processcarpel development
GO:0048441Biological Processpetal development
GO:0048442Biological Processsepal development
GO:0048443Biological Processstamen development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLSEFCST  60
SSMMQTLEKY QQCSYASLDP MQSASDHTQN NYHEYLRLKA RVELLQRSQR NLLGEDLGTL  120
NSRELEHLEH QLDSSLKQIR SRKTQNMLDQ LADLQQKEQM LAEANKQLRR KLEESAARVP  180
LRLSWDNGGQ TMQHNRQLPP QTEGFFQPLG LNSSPQFGYS PMGGNEVNAA ATANNMNGFI  240
PGWML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D1e-279317222101Developmental protein SEPALLATA 3
4ox0_C1e-279317222101Developmental protein SEPALLATA 3
4ox0_B1e-279317222101Developmental protein SEPALLATA 3
4ox0_A1e-279317222101Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00030SELEXTransfer from AT2G03710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0687230.0AF068723.1 Nicotiana tabacum MADS-box protein MADS4 (NtMADS4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016436043.10.0PREDICTED: MADS-box protein CMB1-like
SwissprotQ396851e-104CMB1_DIACA; MADS-box protein CMB1
TrEMBLQ9LM090.0Q9LM09_TOBAC; MADS-box protein MADS4
STRINGSolyc12g038510.1.11e-140(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.12e-96MIKC_MADS family protein