PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016432572.1
Common NameH1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 342aa    MW: 38287.2 Da    PI: 5.2469
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016432572.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-092703042155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_016432572.1 270 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 304
                     569*****************************885 PP

2ELK41.23.4e-14224245122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_016432572.1 224 ELKGQLLRKYSGYLGSLKQEFM 245
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-2085129IPR005540KNOX1
PfamPF037905.2E-2387126IPR005540KNOX1
SMARTSM012565.8E-26134185IPR005541KNOX2
PfamPF037912.5E-21138184IPR005541KNOX2
SMARTSM011882.8E-8224245IPR005539ELK domain
PfamPF037895.6E-11224245IPR005539ELK domain
PROSITE profilePS5121311.174224244IPR005539ELK domain
PROSITE profilePS5007112.957244307IPR001356Homeobox domain
SuperFamilySSF466891.45E-19246321IPR009057Homeodomain-like
SMARTSM003891.2E-12246311IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.9E-28249309IPR009057Homeodomain-like
CDDcd000862.48E-12256308No hitNo description
PfamPF059208.0E-17264303IPR008422Homeobox KN domain
PROSITE patternPS000270282305IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEGGGSSGNT SCLMGYNGDD NNNNSGNAAL CPPPMMMMMM PPPINNNNAE SSNNIGGNNN  60
NNILFLPFMD NNNNNPHEDA NCSSTSIKSK IMAHPHYPRL LSAYVNCQKI GAPPEVVARL  120
EEVCATSATI GRNSGGIIGE DPALDQFMEA YCEMLTKYEQ ELSKPFKEAM VFLSRIECQF  180
KALTLTSSSE SVAALGEAID RNGSSEEEVD VNNGFIDPQA EDQELKGQLL RKYSGYLGSL  240
KQEFMKKRKK GKLPKEARQQ LLDWWTRHYK WPYPSESQKL ALAESTGLDQ KQINNWFINQ  300
RKRHWKPSED MQFVVMDAAH PHYYMDNVLG NPFPMDITPT LL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1239248LKQEFMKKRK
2245249KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869300.0JQ686930.1 Nicotiana tabacum cultivar SR1 shoot meristemless (STM) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016432572.10.0PREDICTED: homeobox protein knotted-1-like LET6
SwissprotO222991e-156LET6_SOLLC; Homeobox protein knotted-1-like LET6
TrEMBLQ8GUS60.0Q8GUS6_TOBAC; Knotted-1-like homeobox protein H1
STRINGPGSC0003DMT4000430831e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-140KNOX/ELK homeobox transcription factor