PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009804621.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BBR-BPC
Protein Properties Length: 313aa    MW: 35172 Da    PI: 10.0263
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009804621.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind3152.4e-963431316301
       GAGA_bind  16 paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvenslasalpvgvqvlsgtksids 110
                     +++++   +++++  + aerda+++er+ a++ek+ ++ erd a +qrd+a+aer+ a+ erdn+++al ++e +++ +l  g+   +gtk  ++
  XP_009804621.1  34 DQEAFI--MNTKIRMLFAERDAAVEERDRAVIEKNTVLTERDLAIQQRDTAIAERDTAIKERDNAIAALHFQESTMNGTL--GC-RTRGTKRPNQ 123
                     223444..7888888999*****************************************************999866544..33.4577777776 PP

       GAGA_bind 111 lqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidl.vlngvslD 204
                     ++++   + +ds    r+   ++a+pi+   +e+ ++ ++k+++ +k   +k ak+++k ++k  ++ +++ + + skae++ +dl ++n++++D
  XP_009804621.1 124 TKNHC-DNSTDSVCINRDVPLTDAFPISAISSEVAKALQVKRTKGNKGMSRKSAKSPRK-TKKVSEDLNRHLTTDGSKAEWDAQDLgSINQIKFD 216
                     66633.45555555568888999999998888888877777544444443333344443.44444555555555679*********88******* PP

       GAGA_bind 205 estlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvt 299
                     es++P+PvC+CtG++rqCYkWG+GGWqS+CCtt +S yPLP+ +++r+aRi+grKmS+++f++lL +Laa G+dls p+DLk++WAkHGtn+++t
  XP_009804621.1 217 ESSMPIPVCTCTGIPRQCYKWGSGGWQSSCCTTYLSEYPLPQLPNKRHARIGGRKMSGSVFSRLLTRLAAVGHDLSMPIDLKTYWAKHGTNRYIT 311
                     *********************************************************************************************** PP

       GAGA_bind 300 ir 301
                     i+
  XP_009804621.1 312 IK 313
                     *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062178.8E-931313IPR010409GAGA-binding transcriptional activator
SMARTSM012267.8E-1191313IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MDDGGRRESR RHRMDCSKGG HAPWNVVPPY QMKDQEAFIM NTKIRMLFAE RDAAVEERDR  60
AVIEKNTVLT ERDLAIQQRD TAIAERDTAI KERDNAIAAL HFQESTMNGT LGCRTRGTKR  120
PNQTKNHCDN STDSVCINRD VPLTDAFPIS AISSEVAKAL QVKRTKGNKG MSRKSAKSPR  180
KTKKVSEDLN RHLTTDGSKA EWDAQDLGSI NQIKFDESSM PIPVCTCTGI PRQCYKWGSG  240
GWQSSCCTTY LSEYPLPQLP NKRHARIGGR KMSGSVFSRL LTRLAAVGHD LSMPIDLKTY  300
WAKHGTNRYI TIK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9823150.0FJ982315.1 Solanum tuberosum GAGA-binding transcriptional activator (BBR/BPC4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804621.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_009804622.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_016442557.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
SwissprotQ8S8C61e-107BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A1S3XSA20.0A0A1S3XSA2_TOBAC; protein BASIC PENTACYSTEINE4-like
TrEMBLA0A1U7YRN90.0A0A1U7YRN9_NICSY; protein BASIC PENTACYSTEINE4-like
STRINGXP_009804621.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA92872128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-110basic pentacysteine 4