PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009803689.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 172aa    MW: 19365 Da    PI: 7.3361
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009803689.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.61.1e-34101101101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaC +  + C ++C+lapyfpa+qpk+f+nv +lFG+s++l++l++l+ +e++ am+s++yeA+ar++ PvyG+v+ i++l  +++  ++el+
  XP_009803689.1  10 ACAACNYGMKPCDPHCPLAPYFPADQPKTFQNVYRLFGVSKILQMLHQLDATEKKPAMQSIIYEANARQKHPVYGCVAEIRNLYFNIRLCEQELQ 104
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     +++e+l
  XP_009803689.1 105 KVREQL 110
                     *99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.479110IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-3210107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MDLTNVTNQA CAACNYGMKP CDPHCPLAPY FPADQPKTFQ NVYRLFGVSK ILQMLHQLDA  60
TEKKPAMQSI IYEANARQKH PVYGCVAEIR NLYFNIRLCE QELQKVREQL SLYTKQLENS  120
SSTPGDSVSQ IRSENIIPPS TCGNTLSLFT QDTHGRLQES ALRGTAQFVE YG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803689.11e-128PREDICTED: LOB domain-containing protein 27-like isoform X1
SwissprotQ9STS61e-34LBD27_ARATH; LOB domain-containing protein 27
TrEMBLK4BKI91e-49K4BKI9_SOLLC; Uncharacterized protein
STRINGSolyc03g113360.2.14e-49(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.16e-36LOB domain-containing protein 27