PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009803498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BBR-BPC
Protein Properties Length: 333aa    MW: 37248.9 Da    PI: 9.2399
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009803498.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind3681.7e-11213331301
       GAGA_bind   1 mdddgsre..rnkg....yyepa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllve 88 
                     mdd+g++e  r+k+    ++ ++ +s+k     q+m+++ erda+i+ernlalsek+aa+aerdma lqrd+a+aern a++erdn++++l+++e
  XP_009803498.1   1 MDDSGHHEnaRHKPpqgqWFMQHqPSMK-----QIMAIMGERDAAIQERNLALSEKRAALAERDMAILQRDSAIAERNSAIMERDNAIATLQYRE 90 
                     8999998878998743344555556666.....************************************************************** PP

       GAGA_bind  89 nsla....salpvgvqvlsgtksidslqq.lse.pqledsavelreeekle.alpieeaaeeakekkkkkkrqrakkpkekkak.kkkkkseksk 175
                     ns++    s +p+g+q+ +++k++++ q  +++ pql++++++ ++++++e + p++ aa+e ++++++k++++ak   ++k++ k+ kk +k+ 
  XP_009803498.1  91 NSMNsgnmSPCPPGCQIAHEVKHMHHPQLhVHHqPQLGEPTFNHSDMHMSEsSIPLSPAAPELTKSRRNKRSKEAKAVTSSKRTsKPSKKVKKEG 185
                     **99999889******************964446*********9999987625788888888888877776665554443333325555444444 PP

       GAGA_bind 176 kkvkkesader......................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvst 248
                     ++ +k   de+                      +k+++k+++ +ln+vs+Dest+PvPvCsCtG lr  YkWGnGGWqS+CCt ++S+yPLP+ +
  XP_009803498.1 186 EDLNKTMLDESqewngaqemgggnddvnrqlgvTKTDWKDQGRGLNQVSFDESTMPVPVCSCTGDLRPSYKWGNGGWQSSCCTNNLSMYPLPMLP 280
                     4444444442257889******************************************************************************* PP

       GAGA_bind 249 krrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     ++r+aRi+grKmS++af+klL++LaaeG+dlsnpvDLkd WAkHGtn+++ti+
  XP_009803498.1 281 NKRHARIGGRKMSGSAFTKLLSRLAAEGHDLSNPVDLKDNWAKHGTNRYITIK 333
                     ****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.3E-1551333IPR010409GAGA-binding transcriptional activator
PfamPF062175.4E-981333IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MDDSGHHENA RHKPPQGQWF MQHQPSMKQI MAIMGERDAA IQERNLALSE KRAALAERDM  60
AILQRDSAIA ERNSAIMERD NAIATLQYRE NSMNSGNMSP CPPGCQIAHE VKHMHHPQLH  120
VHHQPQLGEP TFNHSDMHMS ESSIPLSPAA PELTKSRRNK RSKEAKAVTS SKRTSKPSKK  180
VKKEGEDLNK TMLDESQEWN GAQEMGGGND DVNRQLGVTK TDWKDQGRGL NQVSFDESTM  240
PVPVCSCTGD LRPSYKWGNG GWQSSCCTNN LSMYPLPMLP NKRHARIGGR KMSGSAFTKL  300
LSRLAAEGHD LSNPVDLKDN WAKHGTNRYI TIK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9823020.0FJ982302.1 Nicotiana tabacum GAGA-binding transcriptional activator (BBR/BPC3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803507.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803506.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803505.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803504.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803503.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803502.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803501.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803500.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803499.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803498.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803496.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009803495.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
SwissprotQ8L9991e-136BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLH1ZN850.0H1ZN85_TOBAC; GAGA-binding transcriptional activator
STRINGPGSC0003DMT4000095340.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-128basic pentacysteine 6