PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009803494.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 435aa    MW: 47492.1 Da    PI: 9.7915
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009803494.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.71.8e-11286346363
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     ++kr++r   NR +A rs +RK+ +i eLe  v++L++e ++L  ++ +l+k   +l+s +
  XP_009803494.1 286 DSKRAKRILANRQSAARSKERKLRYISELEYNVQTLQTEATTLSTQVTSLQKDFNELTSLN 346
                     68*****************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-14284348IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.944286349IPR004827Basic-leucine zipper domain
PfamPF001702.2E-10287346IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.05E-10288340No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-11288344No hitNo description
CDDcd147031.34E-21289340No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MAQPNSKPPI SHNFGGGASH TRSLSQPSIF SNNGLPPLSP FPHSESSMAS ANSSLKDTSM  60
EEVDVSSRGP PFVSSSTREN TFRYSDSLPP KKGHRRSNSD VPLGFSAMIQ SSLQLMPISG  120
QGVLGGATLL GDPLRRKSGG EVVDKLSSYM NLENMEALNS SITEDKVKDS IASRTKLSSG  180
DSSNNEAESV SKGTSIKRSA DVDITPTTRH FRSLSMDSAI GSFQYGEESP KLTTSLVNCP  240
GQLSSSKSGN ENSDKINFDL GNSEFSEAEM RKIMADERLA EIVVSDSKRA KRILANRQSA  300
ARSKERKLRY ISELEYNVQT LQTEATTLST QVTSLQKDFN ELTSLNNELR FRLQAMEQQA  360
QLRDALHEAL TAEVKRLKLT MGELKEGRLP NSIARQMPMK PNMFQKQRQQ SSEIQQFSVA  420
KPNTATKASA TPASA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803494.10.0PREDICTED: transcription factor RF2a-like
RefseqXP_016478292.10.0PREDICTED: transcription factor RF2a-like
TrEMBLM0ZWF91e-178M0ZWF9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000095381e-177(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12652478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-94bZIP family protein