PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009802928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 301aa    MW: 33846.6 Da    PI: 7.8837
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009802928.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.12.5e-32169225158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     dep++VNaKQyq+Il+RR+ Rakle+++kl +k+rkpylheSRh+hAl+R+Rg+gGrF
  XP_009802928.1 169 DEPIFVNAKQYQAILRRREYRAKLEAQNKL-SKGRKPYLHESRHRHALNRARGPGGRF 225
                     79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.2E-34167228IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.699168228IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-27170225IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.2E-22171193IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860173193IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.2E-22202225IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MQDLLQKDSD HSSVSTAPSI SVRPSWRTSK ESQMQQWLTF PGPQNPEQFG FHFQDQDSSS  60
TQSTGQSCPE VATEGESKIY VKSNMPFQAG YSKSIEKPDE AQSESTLSSH EHDCTYQGNH  120
KQIAYAPFAY SDPYCHGLLA AYGQCSTVYP QMLGPISARV PLPLDYQQDE PIFVNAKQYQ  180
AILRRREYRA KLEAQNKLSK GRKPYLHESR HRHALNRARG PGGRFLNMMK LLESGSPNVT  240
YVLDSPVSNK LQLNRQIMEP KVHHSKNFQE SYSTPTCSGI SNGSNCDDIG QQQPLNYSAF  300
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-19169227260NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802925.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_009802926.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
SwissprotQ9SYH41e-44NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A1U7YVZ90.0A0A1U7YVZ9_NICSY; nuclear transcription factor Y subunit A-3-like isoform X1
STRINGXP_009802925.10.0(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-42nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gao W,Liu W,Zhao M,Li WX
    NERF encodes a RING E3 ligase important for drought resistance and enhances the expression of its antisense gene NFYA5 in Arabidopsis.
    Nucleic Acids Res., 2015. 43(1): p. 607-17
    [PMID:25514924]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  4. Nasim Z,Fahim M,Ahn JH
    Possible Role of MADS AFFECTING FLOWERING 3 and B-BOX DOMAIN PROTEIN 19 in Flowering Time Regulation of Arabidopsis Mutants with Defects in Nonsense-Mediated mRNA Decay.
    Front Plant Sci, 2017. 8: p. 191
    [PMID:28261246]
  5. Du Q,Zhao M,Gao W,Sun S,Li WX
    microRNA/microRNA* complementarity is important for the regulation pattern of NFYA5 by miR169 under dehydration shock in Arabidopsis.
    Plant J., 2017. 91(1): p. 22-33
    [PMID:28332758]
  6. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]