PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009802867.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 230aa    MW: 25768.9 Da    PI: 10.7039
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009802867.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.97.1e-16160213457
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                     ++r +r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +Lkk+ ++l+ e+a
  XP_009802867.1 160 DRRNKRMIKNRESAARSRARKQAYMNELELEVAHLLEENARLKKQQQQLRLESA 213
                     689********************************************9998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-14157221IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.507159211IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-14160212No hitNo description
SuperFamilySSF579591.19E-11161211No hitNo description
PfamPF001707.0E-13161212IPR004827Basic-leucine zipper domain
CDDcd147076.30E-26161215No hitNo description
PROSITE patternPS000360164179IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MWSSTSSRGI SSSSSKSSSS TSSSSSRSPF SPLNHHLNPR LKTMEEVWKD INLSSLQEHT  60
TTYSRDHDHH HQTANFNGMI LQDFLARPFA TDPPPPQAAS PVPATTMLNL NSVPELHFFG  120
QNSMLHPPTP ISQVPFEGLA SSAANGRKRI PEIENNSVGD RRNKRMIKNR ESAARSRARK  180
QAYMNELELE VAHLLEENAR LKKQQQQLRL ESAAQVPKKK SLYRTSTAPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802867.11e-169PREDICTED: protein FD-like
SwissprotQ84JK28e-44FD_ARATH; Protein FD
TrEMBLA1YTV01e-82A1YTV0_SOLLC; Self-pruning G-box protein
STRINGSolyc02g083520.2.13e-82(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35722239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.21e-23basic region/leucine zipper motif 27