PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009802821.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 170aa    MW: 19418.6 Da    PI: 5.6395
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009802821.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.46.5e-133189563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                    ++ +r+++NRe+ArrsR RK++ ++ L   v++L +eN +    ++  ++++ ++++e+
  XP_009802821.1 31 RKRKRMISNRESARRSRMRKQKHLDDLMAQVATLRKENNQILTSMNVTTQHYLNVEAEN 89
                    6789***********************************99999888888888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.7E-102072No hitNo description
SMARTSM003383.6E-182791IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.32992IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.88E-123183No hitNo description
PfamPF001706.0E-103179IPR004827Basic-leucine zipper domain
CDDcd147021.57E-183282No hitNo description
PROSITE patternPS0003603449IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MASSSGTSSG SSLFLQNSGS EEDLQQLVDQ RKRKRMISNR ESARRSRMRK QKHLDDLMAQ  60
VATLRKENNQ ILTSMNVTTQ HYLNVEAENS ILRAQLAELN HRLESLNEII AFLDANNNCN  120
GLANMDHNQE EPYSFNFAQN EPMVDGFNMT NSWNYLCANQ PIMTADVLQY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13051RKRKRMISNRESARRSRMRKQK
24350RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0455700.0AY045570.1 Nicotiana tabacum bZIP transcription factor BZI-2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802821.11e-124PREDICTED: ocs element-binding factor 1-like
RefseqXP_016440531.11e-124PREDICTED: bZIP transcription factor 53-like
TrEMBLQ941L71e-124Q941L7_TOBAC; BZIP transcription factor BZI-2
STRINGPGSC0003DMT4000794745e-95(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53724123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-48basic leucine-zipper 44