PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009802187.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family G2-like
Protein Properties Length: 398aa    MW: 46272.5 Da    PI: 9.1078
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009802187.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.7e-3299152255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtpeLH++Fv+a+e+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  XP_009802187.1  99 PRLRWTPELHRSFVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 152
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.09495155IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-3095153IPR009057Homeodomain-like
SuperFamilySSF466893.05E-1597153IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-2399154IPR006447Myb domain, plants
PfamPF002491.5E-8100151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MTENSMKQAN EEMMTNTMEY IMEKTSSDSS SQSKLVSFVD LNEDNKGESD EEEEVIEISV  60
ENSSEKTTDE GNSENNNNSS GNGRVEKKNV RHYVRSKMPR LRWTPELHRS FVHAIERLGG  120
QERATPKLVL QLMNVRGLSI AHVKSHLQMY RSKKLDESGQ VLGRNYRAMQ GRSYFYGNVG  180
QRYNPRQDFK MKNGAIVLAR NFNYDHDHVK GHFRNSFSRP PYQAKDIFSR YLQWSSNQGS  240
VLNTTREKLC TPRQFQKNGG HEIGPVRSSQ FLEEKRWPPS EFTANQLEEK IADFSNICSA  300
KNSQYLLQQN VAQPYSKWNC RYNTLEQNLE TPTRLEMKED KSFMTGKDWL PDLQLRLSRS  360
TENKNEKNTH HHSKRMDHQS EINTMLSLSL PTYSLSET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-17100154458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802187.10.0PREDICTED: uncharacterized protein LOC104247786
RefseqXP_009802188.10.0PREDICTED: uncharacterized protein LOC104247786
RefseqXP_009802189.10.0PREDICTED: uncharacterized protein LOC104247786
RefseqXP_009802190.10.0PREDICTED: uncharacterized protein LOC104247786
RefseqXP_009802191.10.0PREDICTED: uncharacterized protein LOC104247786
TrEMBLA0A1U7YGB50.0A0A1U7YGB5_NICSY; uncharacterized protein LOC104247786
STRINGXP_009802187.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-36G2-like family protein