PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009801618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 200aa    MW: 23031.1 Da    PI: 4.7775
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009801618.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.91e-35111111101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++r+kC ++C lapyfp++++++f+nv +lFG++n +kll+++ ++++e+++++l+ eA+++ ++PvyG++g+ +kl+ ++e  ++el+
  XP_009801618.1  11 ACAACKHQRKKCDENCQLAPYFPSNRSEDFQNVYRLFGVNNTIKLLNSVADDQKEKTAETLILEAKVWKENPVYGCLGIERKLRAEIEAYEKELE 105
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++++++
  XP_009801618.1 106 MVRKQI 111
                     *99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.02810111IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-3411108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MNADMLMFVG ACAACKHQRK KCDENCQLAP YFPSNRSEDF QNVYRLFGVN NTIKLLNSVA  60
DDQKEKTAET LILEAKVWKE NPVYGCLGIE RKLRAEIEAY EKELEMVRKQ ISFCKEMATL  120
QMQRQQLEEQ LDRSSLALVS PFDVPYHDKK NEAIFMSDTK NFYGYKYDST NLDEVANVEC  180
IAIQGADFDH PAFVEPESAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801618.11e-150PREDICTED: LOB domain-containing protein 22-like
RefseqXP_016471190.11e-150PREDICTED: LOB domain-containing protein 22-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28661752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-28LOB domain-containing protein 22