PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009801495.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 295aa    MW: 34319 Da    PI: 4.6024
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009801495.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.31.1e-1775128356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++ ++q++ Le+ Fe ++++  e++ +LAk++gL+ rqV +WFqNrRa++k
  XP_009801495.1  75 KKRRLLPKQVQFLEKSFEVENKLEPERKIQLAKETGLQPRQVAIWFQNRRARYK 128
                     45577899*********************************************9 PP

2HD-ZIP_I/II122.42.3e-3974165192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl  +qv++LE+sFe e+kLeperK +la+e glqprqva+WFqnrRAR+k+kqlEkdy++Lk+++d+lk+e ++L ke+++Lr+e++
  XP_009801495.1  74 EKKRRLLPKQVQFLEKSFEVENKLEPERKIQLAKETGLQPRQVAIWFQNRRARYKSKQLEKDYDVLKASFDKLKDEYDSLFKENDNLRNEVH 165
                     69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.66570130IPR001356Homeobox domain
SMARTSM003899.5E-1873134IPR001356Homeobox domain
SuperFamilySSF466896.42E-1874140IPR009057Homeodomain-like
CDDcd000862.74E-1675131No hitNo description
PfamPF000464.7E-1575128IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-1978137IPR009057Homeodomain-like
PRINTSPR000315.2E-5101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000315.2E-5110126IPR000047Helix-turn-helix motif
PfamPF021833.2E-17130171IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MNSFILPNES FPLPSKVLDS LWISNSSPTF HGSVSMVNFD DTRGTKTKER SFFPSLDKEE  60
NSNEDYEVSF HQPEKKRRLL PKQVQFLEKS FEVENKLEPE RKIQLAKETG LQPRQVAIWF  120
QNRRARYKSK QLEKDYDVLK ASFDKLKDEY DSLFKENDNL RNEVHLLKEK LFNREQNSEE  180
KEPISPLNTE AQNPTNNMQN LTMMVCKQED ASSAKSDILD SDSPCYADGN YTSFLEPSDS  240
SHAFETETSD FSQEDDSLSR TLLSSLCFPK LEDDLPVNSC HLSFQIEDQS WFCHY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122130RRARYKSKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801495.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLM0ZSV71e-128M0ZSV7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000073761e-128(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-48homeobox 1