PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009801058.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 342aa    MW: 37449.4 Da    PI: 5.2262
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009801058.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.71.9e-16162217358
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                     ++kr rr ++NRe+ArrsR+RK+a ++ Le+ v+++ +eN++L k+l   +++++ 
  XP_009801058.1 162 DIKRIRRQASNRESARRSRRRKQAHLADLENQVDQFRGENESLFKQLADATQQYKD 217
                     58******************************************888877777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.6E-12160216No hitNo description
SMARTSM003383.0E-16160224IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.059162214IPR004827Basic-leucine zipper domain
PfamPF001709.7E-14163219IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-11163215No hitNo description
PROSITE patternPS000360167182IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEKKMANFAN IRDMKKSPSL LALEEYFKTG DGFGGIDHHQ NINYNNNIND DNNNNNNAHA  60
DIFGDICSVA PSFTMSNQEM VNGFSSCALT DKPLWSPNLT PKSCISATVD SQSSICAGSP  120
TPTIMPKMRD SPVTGATSGS YSDDDDVDAE VGPCEQSTDP LDIKRIRRQA SNRESARRSR  180
RRKQAHLADL ENQVDQFRGE NESLFKQLAD ATQQYKDALT NNRVLKSDVE ALRAKVKLAE  240
DMVARGSLTS TSLSHLLQNY LNTPQPLGTN NNSLCRLDNV SPTITVPGEN EWSAISGPNP  300
VIGVENVNAF NRNFKNGGAM SDAVSCVSDV WSWESHVPSI SK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176183RRSRRRKQ
2178183SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801058.10.0PREDICTED: basic leucine zipper 9
SwissprotQ9FUD36e-64BZIP9_ARATH; Basic leucine zipper 9
TrEMBLM1B6Y91e-136M1B6Y9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000384931e-135(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA81392229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-45basic leucine zipper 9