PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009800807.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 288aa    MW: 32755.4 Da    PI: 4.5255
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009800807.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.31.5e-1984136456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++++t++ql+ Le+ Fe ++++  e++ +LAk+lgL+ rq+ +WFqNrRa+++
  XP_009800807.1  84 KRRLTADQLQFLEKSFEVENKLEPERKDQLAKELGLQPRQIAIWFQNRRARWR 136
                     6689************************************************9 PP

2HD-ZIP_I/II125.81.9e-4082173192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     e+krrl+++q+++LE+sFe e+kLeperK +la+eLglqprq+a+WFqnrRAR++tkqlE+dyeaL+++yd+lk++  +L ke+++Lr+++ 
  XP_009800807.1  82 EQKRRLTADQLQFLEKSFEVENKLEPERKDQLAKELGLQPRQIAIWFQNRRARWRTKQLENDYEALRNKYDNLKADYINLLKEKDDLRAQVI 173
                     58**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.73478138IPR001356Homeobox domain
SMARTSM003892.4E-1880142IPR001356Homeobox domain
SuperFamilySSF466892.61E-1982149IPR009057Homeodomain-like
PfamPF000466.2E-1783136IPR001356Homeobox domain
CDDcd000866.54E-1884139No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2185145IPR009057Homeodomain-like
PRINTSPR000316.5E-6109118IPR000047Helix-turn-helix motif
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PRINTSPR000316.5E-6118134IPR000047Helix-turn-helix motif
PfamPF021831.7E-11138179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MAGPELFYGD AAGFNGILLQ NQGLMSSFAT KEAVGSPASF LASGSMVSFR GVNGGNKSAR  60
SFFQSVEENE TDELEEYLHQ PEQKRRLTAD QLQFLEKSFE VENKLEPERK DQLAKELGLQ  120
PRQIAIWFQN RRARWRTKQL ENDYEALRNK YDNLKADYIN LLKEKDDLRA QVIQFTDKLL  180
LKEKEKGELA TSDIKELSDA SPKENMIDQK VSAITLKQHE DLNSVKSDAF DSESLVQSSI  240
LDQSDLSQDE EENLSKNLVV HDHYPMTSSN LSCFGYPGED QGFGFWSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800807.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_016496556.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLM1CDJ81e-103M1CDJ8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000652071e-103(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-40homeobox 1