PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009800767.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 231aa    MW: 25067.5 Da    PI: 8.7169
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009800767.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.63.3e-41501491100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++p  +r da++slvyeA++r+rdPvyG++g i++lqqql++l+ael+
  XP_009800767.1  50 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLLEVPVGQRADAANSLVYEANVRLRDPVYGCMGAISTLQQQLQTLQAELN 144
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_009800767.1 145 AIRSE 149
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.99149150IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4150147IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSRERERLDE IGKKLKTEID ASSQLHMQQQ MGRRQILGPA VGTTLNTITP CAACKLLRRR  60
CAEECPFSPY FSPHEPQKFA AVHKVFGASN VSKLLLEVPV GQRADAANSL VYEANVRLRD  120
PVYGCMGAIS TLQQQLQTLQ AELNAIRSEI LRYKYREAAN SLIASISTSV ADQLPQAPPT  180
PPPPPPPLPS VVVVSSSSST SSVSSLYTPP SSAGANFSAT IHNNSISYFD Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800767.11e-170PREDICTED: LOB domain-containing protein 15-like isoform X2
RefseqXP_016494818.11e-170PREDICTED: LOB domain-containing protein 15-like isoform X2
SwissprotQ8L5T52e-77LBD15_ARATH; LOB domain-containing protein 15
TrEMBLK4CAA21e-118K4CAA2_SOLLC; Uncharacterized protein
STRINGSolyc06g082430.1.11e-118(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-78LOB domain-containing protein 15