PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009800766.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 238aa    MW: 25806.4 Da    PI: 8.7169
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009800766.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.53.6e-41571561100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++p  +r da++slvyeA++r+rdPvyG++g i++lqqql++l+ael+
  XP_009800766.1  57 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLLEVPVGQRADAANSLVYEANVRLRDPVYGCMGAISTLQQQLQTLQAELN 151
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_009800766.1 152 AIRSE 156
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.99156157IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-4157154IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSRESLLLVV NRERLDEIGK KLKTEIDASS QLHMQQQMGR RQILGPAVGT TLNTITPCAA  60
CKLLRRRCAE ECPFSPYFSP HEPQKFAAVH KVFGASNVSK LLLEVPVGQR ADAANSLVYE  120
ANVRLRDPVY GCMGAISTLQ QQLQTLQAEL NAIRSEILRY KYREAANSLI ASISTSVADQ  180
LPQAPPTPPP PPPPLPSVVV VSSSSSTSSV SSLYTPPSSA GANFSATIHN NSISYFDQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754458e-80HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800766.11e-174PREDICTED: LOB domain-containing protein 15-like isoform X1
RefseqXP_016494817.11e-174PREDICTED: LOB domain-containing protein 15-like isoform X1
SwissprotQ8L5T59e-75LBD15_ARATH; LOB domain-containing protein 15
TrEMBLM1CZR81e-110M1CZR8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000782651e-109(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-76LOB domain-containing protein 15