PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009799762.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 384aa    MW: 42364.8 Da    PI: 6.8776
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009799762.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.31e-052361440
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40
                    + C+ ++   +  fC+++++++C  C +  H +  H++v
  XP_009799762.1 23 KPCEYCHLDAALVFCRTDNMFMCLGCDTRVHGNarHERV 61
                    57*****999*********************55889875 PP

2zf-B_box22.91.7e-0761106342
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      ++C+ +e+  ++  C+ +   lC +C   +H+       H+++p+
  XP_009799762.1  61 VWMCEVCEQAAASVTCKADAAALCLSCDRDIHSAnplaqrHERIPV 106
                     689*******9*********************66899999998875 PP

3CCT69.87.1e-24308351144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  XP_009799762.1 308 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRN 351
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.9E-62063IPR000315B-box-type zinc finger
CDDcd000212.53E-62463No hitNo description
PROSITE profilePS501198.7312563IPR000315B-box-type zinc finger
PROSITE profilePS5011910.77959106IPR000315B-box-type zinc finger
PfamPF006431.1E-561106IPR000315B-box-type zinc finger
CDDcd000218.71E-862106No hitNo description
SMARTSM003368.9E-964106IPR000315B-box-type zinc finger
PfamPF062038.4E-18308350IPR010402CCT domain
PROSITE profilePS5101716.638308350IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MGILRGGANC FSGGWGAAAA VAKPCEYCHL DAALVFCRTD NMFMCLGCDT RVHGNARHER  60
VWMCEVCEQA AASVTCKADA AALCLSCDRD IHSANPLAQR HERIPVVPFY DPVESVVKST  120
AATLLVSINN SNSTSMTTTT TTAIAPDFSK VTACLRHHEE DYKFDPWISP NTMTTKLPVN  180
TMEMKPMDFL FSDSENILDF DYSVSIDTNS QPNYNSANDS VVPVQSTIKP LPFQHQEKHF  240
EIDFTQSHIK SYTTPSLSHS VSSSSLDVGI VPDGSSISEI SYPFVRSVNS IIEMGSSAPA  300
EKLIGMNREA RVLRYREKKK NRKFEKTIRY ASRKAYAETR PRIKGRFAKR NDSDGAGVDS  360
DIDQIFSGAG FIANDSRYGV VPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799762.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLA0A1U7Y6K70.0A0A1U7Y6K7_NICSY; zinc finger protein CONSTANS-LIKE 5-like
STRINGXP_009799762.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-102CONSTANS-like 5