PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009799286.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 429aa    MW: 46577.5 Da    PI: 6.5566
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009799286.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1331.3e-10230288563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  XP_009799286.1 230 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTETTTLSAQLTLLQRDTNGLTAEN 288
                     9*********************************************9998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-15226290IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.978228291IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11230281No hitNo description
PfamPF001705.1E-9230284IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-9230284No hitNo description
CDDcd147036.45E-19231280No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MDKSSSHTVG SLPPLGRYSL FSPPGGSSNA KLEQSGLANL PPLGPGNASE SGHFGHGLSA  60
DSSRFSHDIS RMPDNPPKKF GHRRAHSEIL TLPDDISFDS DLGVVGGLDG PSLSDETEED  120
FLSMYLDMDK FNSSSVSSDF QVGESSSSAA AASGSLQIPA MASAASGSDN VGPTASAKPR  180
VRHQHSQSMD GSTTIKPEML MSGIDEASPL ETKKATSAAK LAELALVDPK RAKRIWANRQ  240
SAARSKERKM RYIAELERKV QTLQTETTTL SAQLTLLQRD TNGLTAENSE LKLRLQTMEQ  300
QVHLQDALND ALKEEIQHLK VLTGQGIANG GPMMNFPASF GGNQQFYSNN HAMHTLLAAQ  360
QLQQLQIHSH KQQHQFQQHQ LHQFQQQQQL QHQQQLQEQL HQAGDMNSRS SLSSPQNDNG  420
SDTSAISKD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799286.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-148POF21_ARATH; Probable transcription factor PosF21
TrEMBLK4C6220.0K4C622_SOLLC; Uncharacterized protein
STRINGSolyc06g053350.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39652137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-124bZIP family protein