PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009798750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BBR-BPC
Protein Properties Length: 327aa    MW: 36592.5 Da    PI: 10.1206
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009798750.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind377.72e-11513271301
       GAGA_bind   1 mdddgsre..rnkg.yye...pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllve 88 
                     mdd+g+r+  r+k+ + +   ++ +s+k     q+m+++aerda+i+ernlalsekkaa+aerdma lqrd+a+aern+a++erdn++++l+++e
  XP_009798750.1   1 MDDSGHRDngRHKPpQGQwlmQHqPSMK-----QIMAIMAERDAAIQERNLALSEKKAALAERDMAILQRDSAIAERNNAIMERDNAIATLQYRE 90 
                     999*998888888732222232234444.....************************************************************99 PP

       GAGA_bind  89 nslasalpvgvqvlsgtksidslqq.lse.pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkke 181
                      s++     + +v+++ ++ +++ + + + p++++++++ r+++ +e++p++  a+e ++ +++k   rak+pk+ + +kk+ k     kkvk+e
  XP_009798750.1  91 SSISGGGQIARGVVKHMHHPQQHVHvH-HqPHMGEPTYNPRDMHVNESMPVSPVAPEPTKPRRNK---RAKEPKAMTGSKKTPKA---SKKVKRE 178
                     997766555556665555544443324.359*******************998777666655555...55555554444333322...2333333 PP

       GAGA_bind 182 sader.............................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvs 247
                     ++d +                             sk ++k++dl+ln+v++De+t+PvPvCsCtG+lr CYkWGnGGWqS+CCtt++S+yPLP++
  XP_009798750.1 179 TEDLNqttfgksqewkgaqemgdasddlnrqlavSKPDWKDQDLGLNQVAFDETTMPVPVCSCTGVLRPCYKWGNGGWQSSCCTTNLSMYPLPAV 273
                     33311234566678999****************************************************************************** PP

       GAGA_bind 248 tkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     +++r+aRi+grKmS++af+klL++LaaeG+dlsnpvDLk+hWAkHGtn+++ti+
  XP_009798750.1 274 PNKRHARIGGRKMSGSAFTKLLSRLAAEGHDLSNPVDLKNHWAKHGTNRYITIK 327
                     *****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.0E-1631327IPR010409GAGA-binding transcriptional activator
PfamPF062173.7E-1061327IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MDDSGHRDNG RHKPPQGQWL MQHQPSMKQI MAIMAERDAA IQERNLALSE KKAALAERDM  60
AILQRDSAIA ERNNAIMERD NAIATLQYRE SSISGGGQIA RGVVKHMHHP QQHVHVHHQP  120
HMGEPTYNPR DMHVNESMPV SPVAPEPTKP RRNKRAKEPK AMTGSKKTPK ASKKVKRETE  180
DLNQTTFGKS QEWKGAQEMG DASDDLNRQL AVSKPDWKDQ DLGLNQVAFD ETTMPVPVCS  240
CTGVLRPCYK WGNGGWQSSC CTTNLSMYPL PAVPNKRHAR IGGRKMSGSA FTKLLSRLAA  300
EGHDLSNPVD LKNHWAKHGT NRYITIK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8087240.0KJ808724.1 Nicotiana tabacum GAGA-binding transcriptional activator mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798751.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009798750.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009798749.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009610157.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_009610156.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509516.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509515.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509514.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509513.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016509512.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016451531.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016451530.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016451528.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_016451527.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
SwissprotQ8L9991e-143BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A076L2D60.0A0A076L2D6_TOBAC; GAGA-binding transcriptional activator
STRINGPGSC0003DMT4000095340.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-127basic pentacysteine 6