PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009798613.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 766aa    MW: 87415 Da    PI: 7.7068
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009798613.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR196.82.5e-3076164291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fYn+YA++vGF +r+s+ ++s+r++ i +r++vCskeg++ + +++ +k rr+r ++r+gCka+l+vkk+ +gkw +tk++++HnHel+p
  XP_009798613.1  76 FYNSYARRVGFGTRVSAYRRSRRDNIISSRQLVCSKEGFNPRPDEQ-HKPRRQRIVSRVGCKAHLTVKKQASGKWAITKFVKDHNHELVP 164
                     9***************************************999999.99***************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-2776164IPR004330FAR1 DNA binding domain
PfamPF105518.0E-28282372IPR018289MULE transposase domain
PROSITE profilePS5096611.09566598IPR007527Zinc finger, SWIM-type
PfamPF044343.0E-10568597IPR007527Zinc finger, SWIM-type
SMARTSM005758.4E-8573600IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MFSSFYSIVN LIMESQPLNL ENDAMEFDVG SGEEEEEEDN YKHSSSGLDS RDQCSSSDLE  60
PYEGMEFESE QAARIFYNSY ARRVGFGTRV SAYRRSRRDN IISSRQLVCS KEGFNPRPDE  120
QHKPRRQRIV SRVGCKAHLT VKKQASGKWA ITKFVKDHNH ELVPPDQVHL LRSHRHVSGP  180
ARSLIDTLQA AGLGATRVMS VLIKQSGGIN NVGFTKSDCQ NYMNQTRQRT LGTGAHYILE  240
YLKQKQAEDP GFFYVVQGGP SGNIFWADST SRMNYSYFGD TVTFDTTYRT HRFRVPFAPF  300
IGVNHHCQPV LFGCALLLNE SESSFIWLFQ NWLAAMSGRH PVSITTDHDR IIRSAIADVF  360
PGARHRFCKS NIFRQVQERL SHSLQLFPIF EAEFQKCVNS PETIEEFELC WESLLGRYNL  420
KDDEWLHSMY DARQHWVPIY LRDTFFGETS IAKTSDTTNS FFDGYIDAST NIHILMTRYE  480
KATASRHEKE VKAENDTIYI SPILKTPSPM EKQAANLYTR EIFLMFQREL METLAYPATV  540
INDTRPDVVY QVAKFGEDHK VHYVQYNVFE KKASCSCQLF AFSGIPCKHI LAVFRVKNIL  600
RLPSHYVLKR WTRKAKSEVV LDEDDLGLPS SHNESFTARF EKLSLEATKY VKEGVDSENV  660
YKVAMDALRG ASKKVAAAMC STPAAPKSLD MNKAKEFNLN GNQAGCGDSC LVSQDEKILE  720
LTTAVVNATG ICEAYRAKLL SILREMEEQK LRISLKIQSM RFNQMT
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798613.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_016475931.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A1S4AH040.0A0A1S4AH04_TOBAC; protein FAR1-RELATED SEQUENCE 5-like isoform X1
TrEMBLA0A1U7Y6560.0A0A1U7Y656_NICSY; protein FAR1-RELATED SEQUENCE 5-like isoform X1
STRINGXP_009798613.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]