PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009798305.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 123aa    MW: 14012.2 Da    PI: 8.4795
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009798305.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.68.4e-3851051101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk lrr+C+++C++ pyfp ++p++f +vhk++Gasnv k+l++++e++r d+++sl+ eA +r++dPvyG+vg+++ l++++ +++ +la
  XP_009798305.1   5 RCAACKQLRRRCPSNCIFLPYFPPNNPQRFSYVHKVYGASNVGKMLQQVQEHQRADVADSLYLEAYCRIKDPVYGCVGIVTLLHEEIYHVQCQLA 99 
                     6********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++++++
  XP_009798305.1 100 KVQAQI 105
                     **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.7454105IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-385102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MTSSRCAACK QLRRRCPSNC IFLPYFPPNN PQRFSYVHKV YGASNVGKML QQVQEHQRAD  60
VADSLYLEAY CRIKDPVYGC VGIVTLLHEE IYHVQCQLAK VQAQIDLLKA QAQVQGELQQ  120
QVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754403e-53HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798305.15e-87PREDICTED: LOB domain-containing protein 24-like
RefseqXP_016455407.15e-87PREDICTED: LOB domain-containing protein 24-like
SwissprotP594682e-45LBD24_ARATH; LOB domain-containing protein 24
TrEMBLK4B3D72e-70K4B3D7_SOLLC; Uncharacterized protein
STRINGSolyc01g109240.1.17e-70(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-46LOB domain-containing protein 24