PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009797447.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 678aa    MW: 75582.2 Da    PI: 6.4043
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009797447.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.52.2e-22111210197
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++ +k+a+e+       ++  + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF +   +
  XP_009797447.1 111 FCKILTASDTSTHGGFSVLRKHANEClppldmtQS--TPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLR--GD 201
                     99****************************96544..44558************************************************3..36 PP

                     EE..EEEEE CS
              B3  89 efelvvkvf 97 
                     ++ l+v+v+
  XP_009797447.1 202 NGDLRVGVR 210
                     777799987 PP

2Auxin_resp102.84.3e-34237316183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+++ +svGmRf+m+fe+eds+err++Gt+vgv d+++ +W++SkWrsLk
  XP_009797447.1 237 ASHAITTQTLFVVYYKPRT--SQFIIGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERRFTGTIVGVGDISS-QWSESKWRSLK 316
                     789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.05E-40103240IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.0E-39105226IPR015300DNA-binding pseudobarrel domain
CDDcd100171.51E-19109210No hitNo description
SMARTSM010194.0E-20111213IPR003340B3 DNA binding domain
PROSITE profilePS5086311.632111213IPR003340B3 DNA binding domain
PfamPF023621.9E-20111210IPR003340B3 DNA binding domain
PfamPF065076.5E-32237316IPR010525Auxin response factor
PfamPF023091.7E-5544599IPR033389AUX/IAA domain
SuperFamilySSF542773.48E-13559639No hitNo description
PROSITE profilePS5174527.575563655IPR000270PB1 domain
PfamPF023091.1E-7609653IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MGSDDMYTEL WKACAGPLVD VPRTGERVYY FPQGHIEQLE ASTNQALKQQ IPQFSLPSKI  60
LCRVVHVQLL AETETDEVYA QITLHPEAMQ EEPSSPDPCP PDLPKHAVHS FCKILTASDT  120
STHGGFSVLR KHANECLPPL DMTQSTPTQD LVAKDLHGYE WRFKHIFRGQ PRRHLLTTGW  180
STFVTSKRLV AGDAFVFLRG DNGDLRVGVR HLARQQSHMP QSVISSQNMH LGVLATASHA  240
ITTQTLFVVY YKPRTSQFII GLNKYLEAVS HGFSVGMRFR MRFEGEDSPE RRFTGTIVGV  300
GDISSQWSES KWRSLKIQWD EPASIVRPDR VSPWEIEPFV APTSLDVAQP GIKIKRPRPL  360
ELPHTDISAA TAASSFWYPG SGPTLEVSHL GSVADNQLYW SSEQNNSLSN GVSNTSCRTH  420
LSGAWQHSML ANGPLNMLRD SIEDNKQLTA QSILLDYGSP MSSRASNGLL LDQVNRGNKH  480
AISSTCRLFG IDLRNNSNNT PTSEKDAPNV TSNCADGAPT VHDGSEVDKD QNVEHLNPSE  540
EKKQVQLEAL LNDTHKQGVT SSRTRTKVQM QGVRVGRAVD LTGLSGYDDL ISELEKIFDI  600
KGELCPRNKW EVVYTDDEGD MMLVGDDPWL EFCKMVKRIF IYSSEEVKKM SPRCKLPILS  660
LEGEGTMPSV DSELKSER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-172333916355Auxin response factor 1
4ldw_A1e-172333916355Auxin response factor 1
4ldw_B1e-172333916355Auxin response factor 1
4ldx_A1e-172333916355Auxin response factor 1
4ldx_B1e-172333916355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1354358KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331201e-114AC233120.6 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-101i8 map 1, complete sequence.
GenBankHG9754401e-114HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755131e-114HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009797447.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A1U7XZQ10.0A0A1U7XZQ1_NICSY; Auxin response factor
STRINGXP_009797447.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9