PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009797322.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 287aa    MW: 31865.6 Da    PI: 7.2189
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009797322.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1482.7e-1582138359
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                     ++kr rr+ +NRe+ArrsR+RK+a + eLe+ v +   eN++L k+   +++++ + 
  XP_009797322.1  82 DVKRVRRMLSNRESARRSRRRKQAHLTELETQVSQVRVENSSLLKRFTDISQKYNEA 138
                     579*****************************************9999999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.1E-1276135No hitNo description
SMARTSM003382.1E-1880144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.05982137IPR004827Basic-leucine zipper domain
PfamPF001708.3E-1383135IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.53E-1184134No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
PfamPF124985.2E-43151276IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
FTFNKVVSSF FSFLFFIGAG FGQELAKVQD KDADEPVGIP PLPAVQKKPG IQVRSTTSGS  60
SGEQSDDDEA EGETTQSTDP TDVKRVRRML SNRESARRSR RRKQAHLTEL ETQVSQVRVE  120
NSSLLKRFTD ISQKYNEAAV DNRVLKADVE TLRAKVKMAE ETVKRVTGLN PLFQAMSEIS  180
TMMMPSFTGS PFDSSADAAV PEQDDPRHHY YQAPENSHMP NHTPRMQNGM IDIPSMENAH  240
QSSAAEAIGG DKIGRTSSMQ RVASLEHLQK RVRGEASTCG TQCRKEQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196103RRSRRRKQ
298103SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009797322.10.0PREDICTED: light-inducible protein CPRF2-like, partial
SwissprotQ990901e-101CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLP938391e-147P93839_SOYBN; G/HBF-1
STRINGSolyc01g097330.2.11e-142(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29342444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.14e-49bZIP family protein