PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009797258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 273aa    MW: 29864.3 Da    PI: 6.1004
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009797258.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.95.7e-1087135351
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                     e kr +r   NReA r++R++Kka+ + Le++v  L a N++L k+l+ 
  XP_009797258.1  87 EGKRKKRPLGNREAVRKYREKKKARAASLEDEVVRLRAINQQLMKRLQG 135
                     569******************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-1482153No hitNo description
SMARTSM003384.2E-1084152IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.34787134IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.38E-789134No hitNo description
PfamPF077162.4E-1289134IPR004827Basic-leucine zipper domain
CDDcd146862.77E-1290144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDDGELEFSN QEMLSSSNFG EFPDSGSMDS FFNEILKDTH ACTHTHTCNP PGPDNTHTHT  60
CYHVHTKIVP PLSEDKTASD DTAESAEGKR KKRPLGNREA VRKYREKKKA RAASLEDEVV  120
RLRAINQQLM KRLQGQAVLE SEIARLKCLL VDIRGRIEGE IGSFPYQKPM KSGDVYQNLV  180
NPNLPGAYVM NPCNLQCDDR VYCLHPGSEG KSLDDTALDG QGFDNCEFET LQCLGNQTSE  240
LKEGSGCALG NGAPTGNPSG GSKRKGTRAA IAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ7190627e-59AJ719062.1 Nicotiana tabacum cDNA-AFLP-fragment MBT34-200, cultivar Bright Yellow 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009797256.10.0PREDICTED: uncharacterized protein LOC104243716
RefseqXP_009797257.10.0PREDICTED: uncharacterized protein LOC104243716
RefseqXP_009797258.10.0PREDICTED: uncharacterized protein LOC104243716
RefseqXP_009797259.10.0PREDICTED: uncharacterized protein LOC104243716
RefseqXP_009797260.10.0PREDICTED: uncharacterized protein LOC104243716
RefseqXP_016502370.10.0PREDICTED: basic leucine zipper 23-like
RefseqXP_016502371.10.0PREDICTED: basic leucine zipper 23-like
RefseqXP_016502372.10.0PREDICTED: basic leucine zipper 23-like
RefseqXP_016502373.10.0PREDICTED: basic leucine zipper 23-like
RefseqXP_016502374.10.0PREDICTED: basic leucine zipper 23-like
SwissprotQ8GTS21e-110BZP23_ARATH; Basic leucine zipper 23
TrEMBLK4B4201e-163K4B420_SOLLC; Uncharacterized protein
STRINGSolyc01g111580.2.11e-162(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.17e-98bZIP family protein