PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009794710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 207aa    MW: 22896.2 Da    PI: 8.2667
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009794710.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601345.6e-42411401100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+++la
  XP_009794710.1  41 PCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHRVFGASNIIKFLQELPEFQRADAVSSMVYEANARLRDPVYGCAGAICHLQKQVNELQVQLA 135
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_009794710.1 136 KAQAE 140
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.8540141IPR004883Lateral organ boundaries, LOB
PfamPF031954.9E-4241138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MESSDTTATT ITSPISSRSD SPSSASPPNS PPPRQVVIVS PCAACKILRR RCAEKCVLAP  60
YFPPNDPIKF TTAHRVFGAS NIIKFLQELP EFQRADAVSS MVYEANARLR DPVYGCAGAI  120
CHLQKQVNEL QVQLAKAQAE IVNMQCEQAN LMALICMEMT QSPQASPHHY SLGNLTNITY  180
VNQQCLFTHN LCRAQLQSHF LSWKKNS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755184e-69HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
GenBankHG9754454e-69HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794710.11e-154PREDICTED: LOB domain-containing protein 1-like isoform X3
SwissprotQ9LQR02e-69LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM1CDT52e-92M1CDT5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000653467e-92(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-70LOB domain-containing protein 1