PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009794233.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family G2-like
Protein Properties Length: 299aa    MW: 32742.3 Da    PI: 7.4636
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009794233.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.61.6e-344296155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  XP_009794233.1 42 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMKAMGVKGLTLYHLKSHLQKYRL 96
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-333997IPR009057Homeodomain-like
PROSITE profilePS5129413.2543999IPR017930Myb domain
SuperFamilySSF466891.49E-174198IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-244297IPR006447Myb domain, plants
PfamPF002492.4E-94495IPR001005SANT/Myb domain
PfamPF143797.2E-27143189IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MKMYSALPFG MEGNAIGGGS GGVGEYQNML GDACLVLTAD HKPRLRWTAE LHERFVDAVT  60
QLGGPDKATP KTIMKAMGVK GLTLYHLKSH LQKYRLGKQS KEGAENYKDA SCVAESQESQ  120
DTGSSASGSS KVVTQDINDS GYQVTEAFRV QMEVQRRLHE QLEVQRHVQL RIEAQGKYLQ  180
TILEKACKAL NYKAVASPDL DAAREQLSEL AIKVESDCDG IVTVPSLPEV VTSFENKNAP  240
NMPARIGDCL IDVCFPPNRS PVSPTSIGAL KKRPRAFANA DALPVENNMR QVQWMMTNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-204298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-204298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-204298157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-204298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-204298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-204298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-204298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-204298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-204298258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794233.10.0PREDICTED: myb family transcription factor APL-like isoform X1
RefseqXP_016467388.10.0PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ8LAJ71e-102PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A1S3ZSV70.0A0A1S3ZSV7_TOBAC; myb family transcription factor APL-like isoform X1
TrEMBLA0A1U7XTG20.0A0A1U7XTG2_NICSY; myb family transcription factor APL-like isoform X1
STRINGXP_009794233.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-101G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]