PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009793493.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 114aa    MW: 12655.4 Da    PI: 4.3531
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009793493.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26033.31.4e-101376197
          DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelall 97
                    +vyeA ar+rdPvyG+vg+i+++q+++ +l++el+++
  XP_009793493.1  1 MVYEATARLRDPVYGCVGIISAVQKHVFHLQSELNEA 37
                    69*******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031954.9E-9136IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508918.815141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MVYEATARLR DPVYGCVGII SAVQKHVFHL QSELNEALAE AMFLRTQLSD ALSLPSLIEG  60
SPFTPENHEF LHFQKPSEQN AYANASDALL LLPEAADHYC LQGTEVLPLP YLDI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754459e-69HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009793493.12e-79PREDICTED: LOB domain-containing protein 4-like
RefseqXP_016503569.11e-78PREDICTED: LOB domain-containing protein 25-like isoform X1
RefseqXP_016503570.11e-78PREDICTED: LOB domain-containing protein 25-like isoform X2
TrEMBLM1CN841e-46M1CN84_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000711324e-46(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA131471419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-12LOB domain-containing protein 13