PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009792980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 310aa    MW: 34892.2 Da    PI: 7.1319
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009792980.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.69.1e-4371061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+  +reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++ +l 
  XP_009792980.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNAAQREDAVNSLAYEAEYRLRDPVYGCVGLISLLQHKLRQVQDDLL 101
                     7********************************************************************************************98 PP

          DUF260  96 llkee 100
                      +k+e
  XP_009792980.1 102 NAKKE 106
                     88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6636107IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-437103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNAAQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISLLQ HKLRQVQDDL LNAKKELATY IGPSAMLPIL  120
QPQGFLQPHH MNNPSSSTMM PLNMNPMLGM PTGVPHGGQL MIRDPQQQQQ TIEAQQLAAA  180
MAAREQQEML RNYEQQQQQQ QHPQQQDIVR FNSGFDSTGS VTATGFHQMN SSPISASLAL  240
GSYENNPYNL IQQQQPQQQE QNHPHHQQIH LQPQLLLQQQ QHQTPQQPET PRQQQRAKSE  300
EEGRSVGPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792980.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_016501970.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-89LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-133A0A0B0PS92_G
STRINGSolyc02g090410.2.11e-130(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-76ASYMMETRIC LEAVES 2-like 1