PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009792002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 180aa    MW: 21061.4 Da    PI: 5.631
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009792002.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.53.4e-1481130554
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN++L ++l++ ++
  XP_009792002.1  81 RKQRRMISNRESARRSRMRKQRHLDELWAQVVWLRNENHQLLDKLNHASE 130
                     689***************************************99998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-1477141IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.38179142IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.88E-1381130No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-1181153No hitNo description
PfamPF001707.6E-1281130IPR004827Basic-leucine zipper domain
CDDcd147028.22E-1882131No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MQPTDVTDFY CLLPSNSTQY PSQSSTNYNA STFQLNRLLN PLYHLQITPQ VQEFNPQLTC  60
FNSNSTSDEA DEQQLNLINE RKQRRMISNR ESARRSRMRK QRHLDELWAQ VVWLRNENHQ  120
LLDKLNHASE RQDHVLEENA QLKKEASELR QMITDMQLSS PCPSLRALED EPCSGLSQNE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
193100RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792002.11e-130PREDICTED: basic leucine zipper 43-like
RefseqXP_016471238.11e-130PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC23e-43BZP43_ARATH; Basic leucine zipper 43
TrEMBLK4BC931e-111K4BC93_SOLLC; Uncharacterized protein
STRINGSolyc02g089420.1.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-51basic leucine-zipper 42