PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009790491.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 371aa    MW: 41953.3 Da    PI: 9.5298
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009790491.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.46.2e-082442821755
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                     A+rsR RK+++i eLe+ v++L+ae ++   ele l+++
  XP_009790491.1 244 AQRSRVRKLQYISELERNVQVLQAEGSEVSAELEFLNQQ 282
                     89*******************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0026233292IPR004827Basic-leucine zipper domain
CDDcd147038.85E-16235282No hitNo description
Gene3DG3DSA:1.20.5.1705.5E-8244283No hitNo description
SuperFamilySSF579599.14E-6244286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MANSKGPSNM RHMMYNGKSS LLPPKSPFPS TCPSYVDYPP SSAVTQKGIS KCRDGSHHQR  60
TSSESCLIEE QPSWLDDLLN EPETPVRRGG HRRSSSDSFT YFDAANIANL DYIAQDDNKF  120
RNITPVASWG SQDFDYYKDA RHATFHVDRN SSNQQKSRSR DASPNAKPHL RGFPPSRENV  180
KTQSLGSSFL PQEGERPKSA GSDKQGLLES VTPDPKGSGE KKDSSHSKSS ASENDTKRAK  240
QQFAQRSRVR KLQYISELER NVQVLQAEGS EVSAELEFLN QQSLILSMEN KALKQRLENL  300
AQEQMIKYLE HEVLERERGR LRALYQQQQL PQSQQQQQSS SSHRRSTSRD LDQQFANISL  360
KHKDGSGQLH M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790491.10.0PREDICTED: uncharacterized protein At4g06598-like isoform X1
RefseqXP_009790492.10.0PREDICTED: uncharacterized protein At4g06598-like isoform X1
RefseqXP_016512674.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLA0A0V0I7S10.0A0A0V0I7S1_SOLCH; Putative basic-leucine zipper transcription factor family protein-like
STRINGPGSC0003DMT4000641691e-173(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27651733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-81bZIP family protein