PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009790364.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 207aa    MW: 23447.7 Da    PI: 8.7157
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009790364.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260108.93.8e-3411105195
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCa+Ck++r+kCa+ C+lapyfpae++++f++vhk+FG+snv kl+k+l ee+r++a++slv+eA +r+++Pv G++g ++++ ++l+  k++ +
  XP_009790364.1  11 ACASCKHQRKKCANTCILAPYFPAEKSREFQAVHKIFGVSNVAKLIKTLIEEDRKKAADSLVWEAFCRQKNPVLGSYGEYRRVVEELKLYKSQYQ 105
                     7***********************************************************************************99999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.53710111IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3211106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MQKINGRDTA ACASCKHQRK KCANTCILAP YFPAEKSREF QAVHKIFGVS NVAKLIKTLI  60
EEDRKKAADS LVWEAFCRQK NPVLGSYGEY RRVVEELKLY KSQYQQILQI PTQGATHDMM  120
YNAAQGLNNG YNKKANSMME SWLCSNNIHL QHVQNNMEKL TSDCNGSTII VPQQAIDGFT  180
NHYYLTAGNC NPIDVKRMEN SSWEASS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790364.11e-157PREDICTED: LOB domain-containing protein 27-like
RefseqXP_016466095.11e-157PREDICTED: LOB domain-containing protein 27-like
TrEMBLK4DCG82e-69K4DCG8_SOLLC; Uncharacterized protein
STRINGSolyc12g010810.1.15e-69(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.14e-50LOB domain-containing protein 2