PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009789767.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 329aa    MW: 37198.7 Da    PI: 6.0577
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009789767.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.45.7e-39631621100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dCvlapyfp++++++f n+hklFG+sn++k++++l++  +++am+++++++++ra+dPv G++++i++lq++++  kael+
  XP_009789767.1  63 ACAACKYQRRKCAPDCVLAPYFPHDRQRQFLNAHKLFGVSNITKIIRHLDQPLKDEAMRTIIFQSDVRANDPVGGCYRIIRDLQRHIDYCKAELD 157
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      + ++
  XP_009789767.1 158 IVLHQ 162
                     88776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.19862163IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3663158IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MQNQITTIST SIPNHHHTTH TTFATANNLN HNYSTKRVNN NNNNNNNNNN KNVLLRVNGT  60
GQACAACKYQ RRKCAPDCVL APYFPHDRQR QFLNAHKLFG VSNITKIIRH LDQPLKDEAM  120
RTIIFQSDVR ANDPVGGCYR IIRDLQRHID YCKAELDIVL HQLAYCRAQA VAAAAAASEQ  180
QILADHHATE ESFNENNCDG VVNQADPLVN NNASSYDQQT IDYHPHSYYN HTSCQQGEDD  240
QQYDEIQDGQ LDLADINFPW SLHEQESTST STPNSLMKQL SVHEQCDNIK PILEGITGFG  300
EEGLSFEHDQ AFDQHSYSTR EHSPIEGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009789767.10.0PREDICTED: LOB domain-containing protein 22-like
TrEMBLM1A1B20.0M1A1B2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000124980.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-52LOB domain-containing protein 22