PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009789729.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 326aa    MW: 36553.3 Da    PI: 9.2759
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009789729.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.87.6e-16256300550
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                     +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lk   +
  XP_009789729.1 256 RRQKRMIKNRESAARSRARKQAYTHELENKVSRLEEENERLKR-QK 300
                     79*************************************9994.33 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.0E-14248299No hitNo description
SMARTSM003387.0E-13252320IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634254299IPR004827Basic-leucine zipper domain
PfamPF001701.4E-12256299IPR004827Basic-leucine zipper domain
CDDcd147074.86E-24256304No hitNo description
SuperFamilySSF579591.0E-10256302No hitNo description
PROSITE patternPS000360259274IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MVTHGMGSQG GVGGGKEAKP NVLARQGSLY SLTLDEVQNQ LGNFGKPLNS MNLDELVKTV  60
WTIEASQELG GNDYGAAQHW TNSLHRQSSG ITLSRDLSKK TVDEVWQDIQ QGQQRDSSID  120
KRSQERQLTF GEITLEDFLV KAGVIAESTQ GRRISGLVLG VDSMSLAQQA QWPHYQIPTM  180
HQAPEQQLQQ QQNIIPVFMP GHPVQQPLPV VANPIVDPET QMIMSPSHLM GTLSDTQTSG  240
RKRVAPEDVI EKSVERRQKR MIKNRESAAR SRARKQAYTH ELENKVSRLE EENERLKRQK  300
EMEKILPSVP PPEPKYQLRR TSSGPI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009789729.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_009789731.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES36e-99AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM1AAW11e-180M1AAW1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000185741e-180(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33342448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-100ABA-responsive element binding protein 3