PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009789611.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BBR-BPC
Protein Properties Length: 301aa    MW: 33519.6 Da    PI: 8.2137
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009789611.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind310.46.1e-951130127301
       GAGA_bind  27 qlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla....salpvgvqvlsgtksidslqqlsep 117
                       m+++aerda+irern+al e+k a+aerdma lqrd+alaern+a+ erd++++al l e s++      +++g ++  g+k+i + qq  ++
  XP_009789611.1  11 TYMAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALAERNAAIQERDDAIAALRLGESSINdnnvVPDSPGNDTETGAKHIYNQQQ-MHK 104
                     569********************************************************99998887633333445556666666664444.666 PP

       GAGA_bind 118 qledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesader.................skaekksid 195
                      +++ a + +e  +        + ++++e+k++kk +r+k+ +++k+ k  ++++   ++ +++  +++                 ++ +  + +
  XP_009789611.1 105 TIAEAAHGSTEDPTAG----YLKGTDTSEAKNPKKVRRPKESRHNKQAKIPRQGKIGAESLNMQVISTSsddwvnlqeldsdkegdMQLTSWKDN 195
                     7777777743333222....223445555666666666666666666666666666666666666653346778899999999999555544569 PP

       GAGA_bind 196 lvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWA 290
                     l+ln++++Des++PvPvCsCtG+++ CYkWG GGWqSaCCtttiS+yPLP+ +++r +R++grKmS+gaf+klL++La++Gydls p+DLkdhWA
  XP_009789611.1 196 LGLNQINFDESAMPVPVCSCTGTPQPCYKWGHGGWQSACCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAGQGYDLSVPLDLKDHWA 290
                     *********************************************************************************************** PP

       GAGA_bind 291 kHGtnkfvtir 301
                     kHGtn++ t++
  XP_009789611.1 291 KHGTNRYSTLK 301
                     *******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012264.6E-1062301IPR010409GAGA-binding transcriptional activator
PfamPF062172.5E-8310301IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MMDHNNFTIK TYMAIMAERD AAIRERNMAL EERKRAFAER DMAMLQRDAA LAERNAAIQE  60
RDDAIAALRL GESSINDNNV VPDSPGNDTE TGAKHIYNQQ QMHKTIAEAA HGSTEDPTAG  120
YLKGTDTSEA KNPKKVRRPK ESRHNKQAKI PRQGKIGAES LNMQVISTSS DDWVNLQELD  180
SDKEGDMQLT SWKDNLGLNQ INFDESAMPV PVCSCTGTPQ PCYKWGHGGW QSACCTTTIS  240
MYPLPQISNK RYSRVGGRKM SGGAFSKLLN RLAGQGYDLS VPLDLKDHWA KHGTNRYSTL  300
K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9823010.0FJ982301.1 Nicotiana tabacum GAGA-binding transcriptional activator (BBR/BPC2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009789611.10.0PREDICTED: barley B recombinant-like protein D
RefseqXP_016490468.10.0PREDICTED: barley B recombinant-like protein D
TrEMBLH1ZN840.0H1ZN84_TOBAC; GAGA-binding transcriptional activator
STRINGSolyc02g084230.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80622230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.13e-83basic pentacysteine 6