PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009787529.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 161aa    MW: 18572.6 Da    PI: 6.9724
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009787529.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.77.1e-153189563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                    ++ +r+ +NRe+ArrsR RK++ ++ L   v++L++eN    ++++  ++++a++++e+
  XP_009787529.1 31 RKRKRMLSNRESARRSRMRKQKHLDDLIGQVAQLKKENNNILSNINLTSQQYANVEAEN 89
                    57899************************************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-182791IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.9552992IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-113184No hitNo description
SuperFamilySSF579591.0E-123183No hitNo description
PfamPF001701.7E-113189IPR004827Basic-leucine zipper domain
CDDcd147026.12E-163283No hitNo description
PROSITE patternPS0003603449IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MATSSGNSTG STQILNSGSE EDLQVSMLDE RKRKRMLSNR ESARRSRMRK QKHLDDLIGQ  60
VAQLKKENNN ILSNINLTSQ QYANVEAENS VLRAQMIELS QRLQSLNEIL SYINSNNNNN  120
NNNNGVFETH HHYQEDMMNN SWNLMYVNQP IMASADMLYQ Y
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13051RKRKRMLSNRESARRSRMRKQK
24350RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787529.11e-113PREDICTED: ocs element-binding factor 1-like
RefseqXP_016457191.11e-113PREDICTED: bZIP transcription factor 53-like
TrEMBLA0A0V0H5269e-67A0A0V0H526_SOLCH; Putative ovule protein
STRINGPGSC0003DMT4000094935e-66(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53724123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.13e-43basic leucine-zipper 44