PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009787001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 269aa    MW: 29604.3 Da    PI: 6.2306
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009787001.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.21.5e-0793135850
                     HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                     +r  +N eA r++R++ ka+++ Le++v  L a N++L k+l+
  XP_009787001.1  93 KRPLSNNEAVRKYREKNKARVASLEDEVVRLRAINQQLLKRLQ 135
                     7889***********************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-687153IPR004827Basic-leucine zipper domain
PfamPF077161.3E-1189135IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.6E-1291154No hitNo description
CDDcd146861.33E-1092144No hitNo description
SuperFamilySSF579591.83E-593135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MHNGELELSN QETVSSSNFG EIPECSSTKR LFNEILSDMH ACIHTHTCNP PGPDNSHTHS  60
CYHVHTKVVP PPIEDKILSD DTAESAENKI GKKRPLSNNE AVRKYREKNK ARVASLEDEV  120
VRLRAINQQL LKRLQGQSVL EAEITRLKCL LVDIRGRIEG EIGSFPYQKP MESADVYQNL  180
VNPNLPGAYV MNPCNLQCDD QVYCLQPGSD ELNGQDLISC GFENLQCFGN QGLKEVVPGC  240
ALGDGTPTAS ASCGNKRRGG KHAAMTSWS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787001.10.0PREDICTED: uncharacterized protein LOC104235029 isoform X2
RefseqXP_016436668.10.0PREDICTED: basic leucine zipper 23-like
RefseqXP_016436669.10.0PREDICTED: basic leucine zipper 23-like
SwissprotQ8GTS22e-98BZP23_ARATH; Basic leucine zipper 23
TrEMBLM1AVA61e-136M1AVA6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000311841e-136(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-99bZIP family protein