PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009786680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 176aa    MW: 19742.3 Da    PI: 6.7379
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009786680.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.44.4e-4211109199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+l+r+C+++C +apyf +++pkkfanvhk+FGasnv+k+l+++pe++red+++slvyeAe+r+rdPvyG++g i +lq+++ +l+++l 
  XP_009786680.1  11 SCAACKFLKRRCTPNCQFAPYFRSDEPKKFANVHKVFGASNVSKILNEVPEDQREDTVNSLVYEAEVRLRDPVYGCIGAIASLQRKMVELQHDLM 105
                     6********************************************************************************************99 PP

          DUF260  96 llke 99 
                     l+++
  XP_009786680.1 106 LART 109
                     8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.50110111IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-4111108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MKSNEPRSSS SCAACKFLKR RCTPNCQFAP YFRSDEPKKF ANVHKVFGAS NVSKILNEVP  60
EDQREDTVNS LVYEAEVRLR DPVYGCIGAI ASLQRKMVEL QHDLMLARTR VAYFAAKQNP  120
TTNCSLMLDY DPFNVANVMP SDFADVPVTA GYLDSYVQNS FDMGHCASTN EFGQFP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016497209.11e-131PREDICTED: LOB domain-containing protein 21-like
SwissprotQ9SRL88e-63LBD21_ARATH; LOB domain-containing protein 21
TrEMBLM1CNG67e-94M1CNG6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000712812e-93(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.14e-64LOB domain-containing protein 21