PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009785905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 438aa    MW: 48800.8 Da    PI: 9.9037
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009785905.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.82.1e-39531521100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+Ca+dC+lapyfpae++k+f n+hklFG+sn+lk+lk++p+ ++e+am++l++eA++ra+dPv G+++vi++l++q++  +++l+
  XP_009785905.1  53 ACAACKYQRRRCAPDCPLAPYFPAERQKDFLNAHKLFGVSNILKVLKNVPPFQKENAMKALIFEANIRADDPVGGCHRVIQNLHRQINLYQSQLQ 147
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     l+ ++
  XP_009785905.1 148 LVYHQ 152
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.26552153IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-3853149IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MTNVVNNTQN ISSSATTSAV TTSTGVRSNP KNITRVASRG GGSGGSGANG SQACAACKYQ  60
RRRCAPDCPL APYFPAERQK DFLNAHKLFG VSNILKVLKN VPPFQKENAM KALIFEANIR  120
ADDPVGGCHR VIQNLHRQIN LYQSQLQLVY HQIVRVQEAA IREQQNFNTM TSVRGTNRNL  180
NFDMLPLHGL HGFNKSNSIC LGEAGSSSQI VKGKGVERFN NVEEFEVKTM MTHSNSKQPL  240
IESEDIKPYF GSIHNFKGKG VATELSPSLF AIAKAFFAFA RVAITNCGSQ MRHLQFVFSC  300
IQVLISSSCA DHRGRDSRLV LRIHHMMFSM ALCQMEEYDS GIQIAESDLH PFWAGYLHFG  360
IKGSRRDNFR FIGGLFSVGI VVAVEQGASE EMWWFMSFWA TWFVLRSSVF GALFGIIAYR  420
LSKEMGQLRS VGSAWQWK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009785905.10.0PREDICTED: uncharacterized protein LOC104234106
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA142941012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-34LOB domain-containing protein 22