PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009784433.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 145aa    MW: 16717.8 Da    PI: 5.3293
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009784433.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.47.6e-142482563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                    ++ +r+++NRe+ArrsR RK++++ eL  +  +L ++N+  ++++++ + ++ ++++e+
  XP_009784433.1 24 RKRKRMESNRESARRSRMRKQQRLGELMGETTQLHKQNSICRERIDSVERNYRAMDAEN 82
                    5789*************************************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.1E-121976No hitNo description
SMARTSM003384.7E-192084IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.8752285IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-112476No hitNo description
PfamPF001702.2E-102482IPR004827Basic-leucine zipper domain
CDDcd147021.10E-142576No hitNo description
PROSITE patternPS0003602742IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MASTQQAVSS ASDADQQYAK FDERKRKRME SNRESARRSR MRKQQRLGEL MGETTQLHKQ  60
NSICRERIDS VERNYRAMDA ENNVLRAQIA ELTERLNSLN SLTQFWADAN GFPVELSEIP  120
DALLEPWQLP CPIQPIDASS DMLLF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13643RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD639510.0D63951.1 Nicotiana tabacum mRNA for TBZ17, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784433.11e-104PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP85e-47BZP53_ARATH; bZIP transcription factor 53
TrEMBLO238231e-104O23823_TOBAC; TBZ17
STRINGPGSC0003DMT4000188324e-83(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28102351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.13e-48basic region/leucine zipper motif 53