PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009784336.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 202aa    MW: 22121.3 Da    PI: 4.7971
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009784336.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601383.2e-43491481100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpee+r da++s+vyeA+ar+rdPvyG++gvi +lq+q++ l+ae a
  XP_009784336.1  49 PCAACKILRRRCVDKCVLAPYFPPTDPLKFTIAHRVFGASNIIKMLQELPEEQRADAVNSMVYEANARIRDPVYGCAGVICQLQKQISGLQAEFA 143
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_009784336.1 144 KAQAE 148
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.30448149IPR004883Lateral organ boundaries, LOB
PfamPF031957.2E-4349146IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MECSDNKTTT ISSLTANIVS ATTTSSELIS PRSIISAPPS PPPPVILTPC AACKILRRRC  60
VDKCVLAPYF PPTDPLKFTI AHRVFGASNI IKMLQELPEE QRADAVNSMV YEANARIRDP  120
VYGCAGVICQ LQKQISGLQA EFAKAQAEIL NLKCQNSNLL ALVCMEVTEY QENSSSSNDY  180
GNNTSLFLED NSVYAAWEPL WT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755171e-62HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784336.11e-148PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016458827.11e-148PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLK4C1061e-101K4C106_SOLLC; Uncharacterized protein
STRINGSolyc05g048740.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-74LOB domain-containing protein 1