PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009783835.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 300aa    MW: 31801.6 Da    PI: 8.8634
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009783835.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1452.4e-14219271456
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      +++rr++kNRe+A rsR+RK+a++ eLe  v +Le+eN +L ke  e +ke 
  XP_009783835.1 219 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLLKEEAEKNKER 271
                     689************************************99876544433333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.2E-14215278No hitNo description
SMARTSM003381.6E-11216280IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.001218270IPR004827Basic-leucine zipper domain
PfamPF001709.3E-13218272IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-10220270No hitNo description
CDDcd147073.04E-21220266No hitNo description
PROSITE patternPS000360223238IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MASKVMPSAS TTPNSDRSRS RSRLPQNPTP SSSSSSLLHS DPSRNFGSMN MDELLNNIYS  60
DSPDPFCSAS ETTAPTPAAA GGDGRDVGPS KTVDEVWREI VSGGGGGGGG GGGGGGGGCS  120
REPEMTLEDF LTKAGAVTEE DVRVPVIAPP PATAAPVAGG FVVDNMGNCQ FPMAMQNGPL  180
MGFGNGVVAI AGSGSGSGGS GRGKRRSTVE ELPLDKATQQ KQRRMIKNRE SAARSRERKQ  240
AYTVELESLV TQLEEENARL LKEEAEKNKE RLKQIMENLI PVVEKRRPPR VLRRVRSMSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783835.10.0PREDICTED: G-box-binding factor 4-like
TrEMBLK4B2391e-113K4B239_SOLLC; Uncharacterized protein
STRINGSolyc01g104650.2.11e-113(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27712452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.17e-29G-box binding factor 4