PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009783240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 170aa    MW: 18459.8 Da    PI: 4.9402
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009783240.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26034.17.5e-1129755298
          DUF260 52 eeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98
                     + +++++sl++eA+ r+ +Pv Gavg++++++++++q+++e++l++
  XP_009783240.1 29 PRAQALFKSLLFEACGRTVNPVTGAVGLLSTGNWHVCQKAVETVLVG 75
                    556899***********************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.2E-72572IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MSCNGCRVLR RRCSDNCTLR ACLDGIDDPR AQALFKSLLF EACGRTVNPV TGAVGLLSTG  60
NWHVCQKAVE TVLVGGNLRP VFAGTLTPTA YMDETFESFR CGGAWDIPNQ FSNKSGSFID  120
GSDHTDTTDW VGLEKRWNTM SSIGSETELS DVSLGLDSGN KEPKLLNLFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783240.11e-123PREDICTED: LOB domain-containing protein 38-like isoform X3
RefseqXP_016440615.11e-123PREDICTED: LOB domain-containing protein 38-like isoform X2
SwissprotQ9SN231e-33LBD38_ARATH; LOB domain-containing protein 38
TrEMBLM1BXU31e-85M1BXU3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000553933e-85(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49940.16e-35LOB domain-containing protein 38