PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009780207.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family VOZ
Protein Properties Length: 477aa    MW: 53258.2 Da    PI: 6.152
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009780207.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ412.48.5e-1271984171217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                     pp saflgpkcalwdc+rpa gs+w+   qdycs +ha+la neg pg  pv+rp gi+lkd+llf+al ak++gk+vg+pecegaatakspwna
  XP_009780207.1 198 PPASAFLGPKCALWDCPRPAMGSDWCqksQDYCSDYHASLAPNEGYPGRPPVVRPMGIGLKDNLLFQALGAKAHGKDVGVPECEGAATAKSPWNA 292
                     789**********************944459**************************************************************** PP

             VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                     +elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m+efgglkrsyymdpqp++++ewhlyeyein++da+alyrlel
  XP_009780207.1 293 PELFDLKVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQMMNEFGGLKRSYYMDPQPMKNLEWHLYEYEINKYDACALYRLEL 387
                     *********************************************************************************************** PP

             VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                     klvd+kk +kgkv++ s++dlqk++grlta
  XP_009780207.1 388 KLVDGKKIPKGKVTNVSVSDLQKQMGRLTA 417
                     ****************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MRKVSKRGAC KSASHQLFKD RAKNRVDDLQ GVLTNLQSAR KESRSYDVGL LEEQVHQMLR  60
EWKAELNEPS PASSLQGGSL VSSSDIYRLL LGEEEDDATS PLAAPKPEPD AQKVSVTGFQ  120
EGFNATQVLQ EQGFHLVDQC KGLPLVVNNA GINNLGIATH LDYHSFDLHQ EYDQQYLPGF  180
DALNLCLEDA LPPIHISPPA SAFLGPKCAL WDCPRPAMGS DWCQKSQDYC SDYHASLAPN  240
EGYPGRPPVV RPMGIGLKDN LLFQALGAKA HGKDVGVPEC EGAATAKSPW NAPELFDLKV  300
VEGETIREWL FFDKPRRAFE SGNRKQRSLP DYNGRGWHES RKQMMNEFGG LKRSYYMDPQ  360
PMKNLEWHLY EYEINKYDAC ALYRLELKLV DGKKIPKGKV TNVSVSDLQK QMGRLTAEFP  420
LDNKRTVKGR AKAANLKNVG NIQAAPIPMV PSCEGFDYGT GEPYDYLVDD LDGYFIT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0145160.0BT014516.1 Lycopersicon esculentum clone 133906R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780205.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_009780206.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_009780207.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_016472599.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_016472601.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_016472602.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1S4A7N10.0A0A1S4A7N1_TOBAC; transcription factor VOZ1-like
TrEMBLA0A1U7WSB80.0A0A1U7WSB8_NICSY; transcription factor VOZ1-like
STRINGXP_009780205.10.0(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]