PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009778037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 230aa    MW: 25951.1 Da    PI: 10.0997
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009778037.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1025.7e-3272128158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq Rak+e ekk  +k+rkpylheSRh+hA+rR+Rg+gGrF
  XP_009778037.1  72 EEPVYVNAKQYHGILRRRQIRAKAELEKKA-IKARKPYLHESRHQHAMRRARGTGGRF 128
                     69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-3670131IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.03971131IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-2773128IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.6E-247496IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068607696IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.6E-24105128IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MQYKQHLKHI TSTTAAIMGE HQKELTGHSA MLTSYPYPDL QYGGMMTYGA PVHPHLFEIH  60
HARMPLPLDM EEEPVYVNAK QYHGILRRRQ IRAKAELEKK AIKARKPYLH ESRHQHAMRR  120
ARGTGGRFLN TKKLNDMDCT TEEPKKYGAT IPTHSGNSSG SGSSDQREKE GYTVQDMHKG  180
RSRSFSTSNG HGSSMYFSEN TGNEQRNGYY GRGSWSLLVS QASRGAAPNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-2072132262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-127HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778037.11e-173PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_016443427.11e-173PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_016443428.11e-173PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X2
SwissprotQ945M97e-37NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A1S3XU071e-172A0A1S3XU07_TOBAC; nuclear transcription factor Y subunit A-9-like isoform X2
TrEMBLA0A1S3XUQ61e-171A0A1S3XUQ6_TOBAC; nuclear transcription factor Y subunit A-1-like isoform X1
TrEMBLA0A1U7WDJ11e-172A0A1U7WDJ1_NICSY; nuclear transcription factor Y subunit A-7-like
STRINGXP_009778037.11e-172(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112322025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.18e-29nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]