PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009777754.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 313aa    MW: 34769.6 Da    PI: 5.7867
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009777754.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.26.7e-39101101101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+C +dC+lapyfpa+qpk f+n+h+lFG+sn+lk+lk+l++++++ am+s++y+A+ar + PvyG+v+ i++l  +++  ++el+
  XP_009777754.1  10 ACAACKYQRRRCISDCPLAPYFPADQPKMFQNAHRLFGVSNILKILKQLDPSQKKVAMKSIIYQANARDKHPVYGCVAEIQNLVFNIQLYEEELQ 104
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     +++++l
  XP_009777754.1 105 AVHAQL 110
                     *99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.529110IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-3710107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRR CISDCPLAPY FPADQPKMFQ NAHRLFGVSN ILKILKQLDP  60
SQKKVAMKSI IYQANARDKH PVYGCVAEIQ NLVFNIQLYE EELQAVHAQL AFYRQQQQHQ  120
QQEISSTALS DSVSHIQLGM PPPPAVAAPP PPPQPDNGNG LTLFHQGTPS QQYNAAVNDN  180
ALPVQSYPSY SNNSYAAYNN NTTFVDPKEN NAVNSLWIQQ SYGNSAYNSN TMIMQSQLPS  240
SQAISVPPEV TQDYDEIHPF FDTIDDRQSY IDSKEAYDSS SESSLKDTRH SVEHVAENEL  300
KSAAACFTLT SVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777754.10.0PREDICTED: LOB domain-containing protein 27-like
RefseqXP_016511440.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLM1B0F51e-175M1B0F5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000342881e-175(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.14e-52LOB domain-containing protein 27