PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009776936.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 363aa    MW: 41301.1 Da    PI: 7.5429
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009776936.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.9e-1080109433
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLee 33 
                      k++rr+++NReAAr+sR RKka++++Le+
  XP_009776936.1  80 EKVQRRLAQNREAARKSRMRKKAYVQQLET 109
                     599*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-677137IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-977121No hitNo description
PROSITE profilePS502179.11779123IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.19E-781116No hitNo description
PfamPF001703.7E-781111IPR004827Basic-leucine zipper domain
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PfamPF141443.1E-28167240IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNMTSPTTQF APTRRMGIYE PFHQMSVWED AFRGDIMPSS DPCMVSQPND RPDDKSGYTS  60
GEQHMPSGSG DNQAPRSTSE KVQRRLAQNR EAARKSRMRK KAYVQQLETS RLKLAQLELE  120
LERARQQGLY MLGSNSNMGL LGTINPGIAA FEMEYSHWVE EQQKKNAELR SILQSPVSEM  180
ELQLLVENVL SHYFNLFRMK ADAAKADVFY LMSGMWRTTV ERFFLWIGGF KPSDLINVVM  240
PQLEPLTDQQ IIKVCNLRHC CQQAEDALTQ GMDKLQQTLA QSILNMTTGA GNYSSQMVSS  300
MENLEALESF VNQADHLRQQ TLQQMSIILT TRQAARGLLA FGEYLQRLRA LSSLWAARPR  360
EPT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0142160.0BT014216.1 Lycopersicon esculentum clone 133394F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776929.10.0PREDICTED: transcription factor TGA1-like
RefseqXP_009776936.10.0PREDICTED: transcription factor TGA1-like
RefseqXP_016467889.10.0PREDICTED: transcription factor TGA1-like
RefseqXP_016467890.10.0PREDICTED: transcription factor TGA1-like
SwissprotQ392371e-157TGA1_ARATH; Transcription factor TGA1
TrEMBLK4BTN30.0K4BTN3_SOLLC; Uncharacterized protein
STRINGSolyc04g072460.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-144bZIP family protein