PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009776508.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family VOZ
Protein Properties Length: 476aa    MW: 52868.4 Da    PI: 5.5422
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009776508.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ423.73e-1301964151217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                     pppsaflgpkc+lwdc+rpa gs+w+q   dycs +ha+la neg pgt pv+rp gi+lkd+llf+alsak qgk+vgipecegaatakspwna
  XP_009776508.1 196 PPPSAFLGPKCSLWDCPRPAMGSDWCQkshDYCSDYHASLAPNEGYPGTPPVVRPMGIGLKDNLLFQALSAKSQGKDVGIPECEGAATAKSPWNA 290
                     89***********************976668**************************************************************** PP

             VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                     +elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+e+gglkrsyymdpqp++++ewhlyeyein++d +alyrlel
  XP_009776508.1 291 PELFDLKVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEYGGLKRSYYMDPQPMKNLEWHLYEYEINKYDPCALYRLEL 385
                     *********************************************************************************************** PP

             VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                     klvd+kks+kgkv+k+s+adlqk++grlta
  XP_009776508.1 386 KLVDGKKSPKGKVTKESVADLQKQMGRLTA 415
                     ****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MGKGSKSGAG KSASHQLFKD KAKNRVDDLQ GVFTNLQSAR KESRTYDVGV LEEQVHQMLR  60
EWRAELNEPS PASSLQGGSL VSSDIYRLLL GEEEDDATSA LAAPKPEPDA QKNDVAAFQE  120
GFNVTPVLQE QGYQLVDQCK SMPLVVNNAG INNLGIATQQ DYNSFDLQQD FDQYFPGFDA  180
LNLCLEDVLP PVHISPPPSA FLGPKCSLWD CPRPAMGSDW CQKSHDYCSD YHASLAPNEG  240
YPGTPPVVRP MGIGLKDNLL FQALSAKSQG KDVGIPECEG AATAKSPWNA PELFDLKVVE  300
GETIREWLFF DKPRRAFESG NRKQRSLPDY NGRGWHESRK QVMNEYGGLK RSYYMDPQPM  360
KNLEWHLYEY EINKYDPCAL YRLELKLVDG KKSPKGKVTK ESVADLQKQM GRLTAEFPSE  420
NKRSVKGRAK ANSKDVAVNM HAVPNLIVPA SEGLNYGTGA PFPDYLVDNL GGYYVT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776508.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_009776509.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_016491038.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_016491039.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1S4BQG30.0A0A1S4BQG3_TOBAC; transcription factor VOZ1-like
TrEMBLA0A1U7WPA80.0A0A1U7WPA8_NICSY; transcription factor VOZ1-like
STRINGXP_009776508.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]