PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009776231.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 189aa    MW: 20688.4 Da    PI: 5.9007
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009776231.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.61.8e-4241139199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C ++Cvlapyfp ++p kf n+h++FGasn++k l++l e++r da++s+vyeA+ar+rdPvyG++g i++lq+q++ l+a+la
  XP_009776231.1  41 PCAACKILRRRCIDKCVLAPYFPPTEPLKFTNAHRVFGASNIIKSLQELGEDQRADAVNSMVYEANARIRDPVYGCAGAIWQLQKQISDLQAQLA 135
                     7********************************************************************************************** PP

          DUF260  96 llke 99 
                     +++ 
  XP_009776231.1 136 KAQV 139
                     9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.37840141IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-4241138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MDCVNKTTII TTSQTLASSS FSAGGSTAAP PSSPPVVPIT PCAACKILRR RCIDKCVLAP  60
YFPPTEPLKF TNAHRVFGAS NIIKSLQELG EDQRADAVNS MVYEANARIR DPVYGCAGAI  120
WQLQKQISDL QAQLAKAQVE MLNVQSQNAN LEMSQNQVNK DKNDAQFYGN TSLFLEDNSV  180
YAAWEPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776231.11e-140PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016480967.11e-140PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR05e-71LBD1_ARATH; LOB domain-containing protein 1
TrEMBLK4BRX48e-78K4BRX4_SOLLC; Uncharacterized protein
TrEMBLW9RZL73e-77W9RZL7_9R
STRINGSolyc04g050010.1.12e-77(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-72LOB domain-containing protein 1